missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FOS Recombinant Protein
Marca: Abnova™ H00002353-P01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH04490 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
67.54 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL | |
AP-1/C-FOS | |
FOS | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
2353 | |
FOS (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FOS | |
Human | |
Recombinant | |
Solution |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ FOS Recombinant Protein > 10μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido