missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DNAJD1 Recombinant Protein

Marca:  Abnova™ H00029103-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16169012

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 02-04-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH10910
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
42.24
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
DNAJD1/HSD18/MCJ
DNAJC15
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
29103
DNAJD1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DNAJC15
Human
Recombinant
Solution
Recomendaciones

Recomendaciones

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales