missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ C1D Recombinant Protein Código de producto.: 16135092

Abnova™ C1D Recombinant Protein

Product Code. 16135092
25 μg, 25 microgramos
Click to view available options
Cantidad:
10 μg
2 μg
25 μg
Unit Size:
10 microgramos
2 microgramos
25 microgramos
This item is not returnable. View return policy

Código de producto. 16135092

Marca: Abnova™ H00010438P02.25ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Número de acceso AAH05235
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 10438
Peso molecular 41.25
Nombre C1D (Human) Recombinant Protein (P02)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 25 μg
Fuente Wheat Germ (in vitro)
Inmunógeno MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen MGC12261/MGC14659/SUNCOR
Nombre común C1D
Símbolo de gen C1D
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ C1D Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.