missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AAVR/KIAA0319L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57263-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
AAVR/KIAA0319L Polyclonal specifically detects AAVR/KIAA0319L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| KIAA0319L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| FLJ44532, KIAA0319-like, KIAA1837dyslexia-associated protein KIAA0319-like protein, polycystic kidney disease 1-related | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79932 | |
| Human | |
| Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KIAA0319L | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQ | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
AAVR/KIAA0319L Antibody, Novus Biologicals™ > 25 μL, Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido