missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. AAVR/KIAA0319L Antibody, Novus Biologicals™

AAVR/KIAA0319L Antibody, Novus Biologicals™

Código de producto. p-200082747 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18201115 100 μL 100 microlitros
18627918 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18201115 Supplier Novus Biologicals Supplier No. NBP257263

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

AAVR/KIAA0319L Polyclonal specifically detects AAVR/KIAA0319L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno KIAA0319L
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen FLJ44532, KIAA0319-like, KIAA1837dyslexia-associated protein KIAA0319-like protein, polycystic kidney disease 1-related
Símbolos de los genes KIAA0319L
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQ
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 79932
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.