Sequence: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
C-C chemokine receptor type 9; C-C CKR-9; CDw199; CDw199/GPR-9-6/GPR28; chemokine (C-C motif) receptor 9; G protein-coupled receptor 28; G-protein coupled receptor 28; GPR-9-6
Cat # 16117388
100 µg
Cat # 15793253
25 Tests
Cat # 15792613
100 Tests
Cat # 15782593
100 ug
Cat # 15211837
100 ug
Cat # 15702603
100 ug
Cat # 15703263
100 Tests
Cat # 15976310
100µg
Cat # 15729243
100 ug
Cat # 15742593
100 ug
Cat # 15334741
50 µg
Cat # 15713273
100 ug
Cat # 15749243
100 ug
Cat # 15956340
100µg
Cat # 15734544
500 ug
Cat # 15762623
100 ug
Cat # 17277073
100 µL
Cat # 16046357
50 ug
Cat # 15231247
100 Tests
Cat # 15722623
100 ug
Cat # 15733263
25 Tests
Cat # 11516422
100 µg
Cat # 15743263
100 Tests
Cat # 15742623
25 Tests
Cat # 15782613
25 Tests
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.