missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Porcine Trypsin Protein

A cDNA sequence encoding the Trypsin was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10897-2.5mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15995498

Cantidad Precio
1 183.80€ / 2.50 miligramo
10 171.24€ / 2.50 miligramo
Envío estimado: 01-03-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.



Descripción

Descripción

Especificaciones

Especificaciones

Trypsin Protein
Research Use Only
Recombinant Protein
Pichia Pastoris
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
2.5 mg
< 1.0 EU per ug protein as determined by the LAL method.
Porcine
Untagged
The Porcine Trypsin (2.98 mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH 3.
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales