missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein
A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP11985-500ug
Detalles adicionales : Peso : 0.01000kg
Especificaciones
Gliadin Gamma Wheat Protein | |
500 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Other | |
His | |
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2. |
Protein is >90% pure. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH |