missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP11985-500ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15959008

  • 800.00€ / 500 microgramos
Fecha estimada de envío: 27-03-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

Gliadin Gamma Wheat Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
His
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.
Protein is >90% pure.
Research Use Only
Recombinant Protein
E. coli
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales