missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SYK Protein

A cDNA sequence encoding the SYK was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13656-10ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15944289

  • 181.00€ / 10 microgramos
Fecha estimada de envío: 31-01-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

6850
Greater than 85.0% as determined by SDS-PAGE.
Research Use Only
SYK
Human
Flag Tag
SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
SYK Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales