missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PON2 Protein

A cDNA sequence encoding the PON2 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13110-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15932539

  • 120.00€ / 2 microgramos
Fecha estimada de envío: 03-02-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

PON2 Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
PON2 is supplied in PBS and 50% glycerol.
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Research Use Only
Recombinant Protein
E. coli
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales