missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PON2 Protein

A cDNA sequence encoding the PON2 was constructed and used to recombinantly synthesize the protein.

120.00€ - 6390.00€

Especificaciones

Nombre PON2 Protein
Pureza Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Estado normativo Research Use Only
Concentración de endotoxinas Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Tipo de producto Recombinant Protein
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15932539
Ver documentos Detalles de la promoción
enQuireBio™
QP13110-2UG
2 μg
120.00€
2 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15912539
Ver documentos Detalles de la promoción
enQuireBio™
QP13110-10UG
10 μg
181.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15922539
Ver documentos Detalles de la promoción
enQuireBio™
QP13110-1MG
1 mg
6390.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

PON2 Protein
Research Use Only
Recombinant Protein
E. coli
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
PON2 is supplied in PBS and 50% glycerol.
SDS
Product Certifications