missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12946-EC-1mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15932039

  • 4026.00€ / 1 miligramo


Fecha estimada de envío
16-10-2019
Añadir a la cesta

Especificaciones

Especificaciones

1029
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
CDKN2A
Human
Untagged
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
p16-INK4a Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Videos
Documentos