missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

120.00€ - 4685.00€

Especificaciones

ID de gen (Entrez) 1029
Nombre p16-INK4a Protein
Pureza Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Estado normativo Research Use Only
Concentración de endotoxinas Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15942039
Ver documentos Detalles de la promoción
enQuireBio™
QP12946-EC-5UG
5 μg
120.00€
5 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15922039
Ver documentos Detalles de la promoción
enQuireBio™
QP12946-20UG
20 μg
181.00€
20 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15932039
Ver documentos Detalles de la promoción
enQuireBio™
QP12946-EC-1MG
1 mg
4685.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

1029
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
p16-INK4a Protein
Research Use Only
CDKN2A
Human
Untagged
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
SDS
Product Certifications