missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human p16-INK4a Protein
A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.
120.00€ - 4685.00€
Especificaciones
ID de gen (Entrez) | 1029 |
---|---|
Nombre | p16-INK4a Protein |
Pureza | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Estado normativo | Research Use Only |
Concentración de endotoxinas | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
15942039
|
enQuireBio™
QP12946-EC-5UG |
5 μg |
120.00€
5 microgramos |
Fecha estimada de envío: 22-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
15922039
|
enQuireBio™
QP12946-20UG |
20 μg |
181.00€
20 microgramos |
Fecha estimada de envío: 22-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
15932039
|
enQuireBio™
QP12946-EC-1MG |
1 mg |
4685.00€
1 miligramo |
Fecha estimada de envío: 22-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
Especificaciones
1029 | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
p16-INK4a Protein | |
Research Use Only | |
CDKN2A | |
Human | |
Untagged | |
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4. |