missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human LR3 IGF1 Protein

A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10775-1mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15935128

  • 214.00€ / 1 miligramo


Fecha estimada de envío
18-12-2019
Añadir a la cesta

Especificaciones

Especificaciones

LR3 IGF1 Protein
1 mg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Greater than 95.0% as determined by SDS-PAGE and HPLC.
Research Use Only
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Human
Untagged
Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS.
Videos
Documentos