missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human LR3 IGF1 Protein
A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.
137.00€ - 276.00€
Especificaciones
Nombre | LR3 IGF1 Protein |
---|---|
Estado normativo | Research Use Only |
Concentración de endotoxinas | < 1.0 EU per ug protein as determined by the LAL method. |
Actividad biológica | The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. |
Tipo de producto | Recombinant Protein |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
15945128
|
enQuireBio™
QP10775-200UG |
200 μg |
137.00€
200 microgramos |
Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
15955128
|
enQuireBio™
QP10775-500UG |
500 μg |
187.00€
500 microgramos |
Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
15935128
|
enQuireBio™
QP10775-1MG |
1 mg |
276.00€
1 miligramo |
Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Especificaciones
LR3 IGF1 Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA | |
Greater than 95.0% as determined by SDS-PAGE and HPLC. |
Research Use Only | |
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | |
Human | |
Untagged | |
Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS. |