enQuireBio™ Recombinant Human LR3 IGF1 Protein

A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.

137.00€ - 276.00€

Nombre	LR3 IGF1 Protein
Estado normativo	Research Use Only
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Actividad biológica	The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Tipo de producto	Recombinant Protein

Ver más especificaciones

Productos 3

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
15945128 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10775-200UG	200 μg	137.00€ 200 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15955128 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10775-500UG	500 μg	187.00€ 500 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15935128 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10775-1MG	1 mg	276.00€ 1 miligramo Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Especificaciones

Nombre	LR3 IGF1 Protein
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Tipo de producto	Recombinant Protein
Especie	E. coli
Secuencia	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Grado de pureza o calidad	Greater than 95.0% as determined by SDS-PAGE and HPLC.

Estado normativo	Research Use Only
Actividad biológica	The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Reactividad cruzada	Human
Etiqueta de proteína	Untagged
Tampón	Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS.

Descripción