missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human LR3 IGF1 Protein
A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.
120.00€ - 241.00€
Especificaciones
| Nombre | LR3 IGF1 Protein |
|---|---|
| Pureza | Greater than 95.0% as determined by SDS-PAGE and HPLC. |
| Estado normativo | Research Use Only |
| Concentración de endotoxinas | < 1.0 EU per ug protein as determined by the LAL method. |
| Actividad biológica | The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
15945128
|
enQuireBio™
QP10775-200UG |
200 μg |
120.00€
200 microgramos |
Fecha estimada de envío: 23-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
15955128
|
enQuireBio™
QP10775-500UG |
500 μg |
157.00€
500 microgramos |
Fecha estimada de envío: 23-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
15935128
|
enQuireBio™
QP10775-1MG |
1 mg |
241.00€
1 miligramo |
Fecha estimada de envío: 23-03-2023 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. |
Especificaciones
| LR3 IGF1 Protein | |
| Research Use Only | |
| The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | |
| Human | |
| Untagged | |
| Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS. |
| Greater than 95.0% as determined by SDS-PAGE and HPLC. | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA |