missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human LR3 IGF1 Protein

A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.

120.00€ - 241.00€

Especificaciones

Nombre LR3 IGF1 Protein
Pureza Greater than 95.0% as determined by SDS-PAGE and HPLC.
Estado normativo Research Use Only
Concentración de endotoxinas < 1.0 EU per ug protein as determined by the LAL method.
Actividad biológica The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15945128
Ver documentos Detalles de la promoción
enQuireBio™
QP10775-200UG
200 μg
120.00€
200 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 23-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15955128
Ver documentos Detalles de la promoción
enQuireBio™
QP10775-500UG
500 μg
157.00€
500 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 23-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15935128
Ver documentos Detalles de la promoción
enQuireBio™
QP10775-1MG
1 mg
241.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 23-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

LR3 IGF1 Protein
Research Use Only
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Human
Untagged
Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS.
Greater than 95.0% as determined by SDS-PAGE and HPLC.
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
SDS
Product Certifications