missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FLT1 D3 Protein

A cDNA sequence encoding the FLT1 D3 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10612-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15994408

Cantidad Precio
1 129.74€ / 2 microgramos
10 121.33€ / 2 microgramos
Envío estimado: 03-03-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.



Descripción

Descripción

Especificaciones

Especificaciones

2321
Greater than 90.0% as determined by SDS-PAGE.
Research Use Only
FLT1
Recombinant Protein
Insect
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
FLT1 D3 Protein
2 μg
< 1.0 EU per ug protein as determined by the LAL method.
The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Human
Untagged
FLT1 D1-3 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales