missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FLT1 D3 Protein

A cDNA sequence encoding the FLT1 D3 was constructed and used to recombinantly synthesize the protein.

137.00€ - 1500.00€

Especificaciones

Nombre FLT1 D3 Protein
Tipo de producto Recombinant Protein
Etiqueta de proteína Untagged
Especie del huésped Insect
reactividad cruzada Human
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15994408
Ver documentos Detalles de la promoción
enQuireBio™
QP10612-2UG
2 μg
137.00€
2 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15984408
Ver documentos Detalles de la promoción
enQuireBio™
QP10612-10UG
10 μg
205.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15974408
Ver documentos Detalles de la promoción
enQuireBio™
QP10612-100UG
100 μg
1500.00€
100 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

FLT1 D3 Protein
Untagged
Human
Greater than 90.0% as determined by SDS-PAGE.
FLT1
Recombinant Protein
Insect
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
2321
SDS
Product Certifications