missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12178-B-100ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15939608

  • 338.00€ / 100 microgramos
Fecha estimada de envío: 03-02-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

Hepatitis C HCV NS4 a+b Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis C
Biotin
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales