missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

338.00€ - 2000.00€

Especificaciones

Nombre Hepatitis C HCV NS4 a+b Protein
Pureza HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Estado normativo Research Use Only
Concentración de endotoxinas Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Tipo de producto Recombinant Protein
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15939608
Ver documentos Detalles de la promoción
enQuireBio™
QP12178-B-100UG
100 μg
338.00€
100 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15959608
Ver documentos Detalles de la promoción
enQuireBio™
QP12178-B-500UG
500 μg
1200.00€
500 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15949608
Ver documentos Detalles de la promoción
enQuireBio™
QP12178-B-1MG
1 mg
2000.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 22-03-2023
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

Hepatitis C HCV NS4 a+b Protein
Research Use Only
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis C
Biotin
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
SDS
Product Certifications