missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marca: Bio-Techne NBP1-89483
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MAP4 Polyclonal specifically detects MAP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
MAP4 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
DKFZp779A1753, MAP-4, MGC8617, microtubule-associated protein 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MAP4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT | |
0.1 mL | |
Cellular Markers | |
4134 | |
Human | |
IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
MAP4 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido