Learn More
Abnova™ ID1 Recombinant Protein
Human ID1 full-length ORF recombinant protein with GST-tag at N-terminal
335.00€ - 508.00€
Especificaciones
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
---|---|
Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Peso molecular | 43.2 |
Intervalo de pH | 8 |
Método de preparación | In vitro wheat germ expression system |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16196531
|
Abnova™
H00003397-P01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 11-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
16106541
|
Abnova™
H00003397-P01.25UG |
25μg |
508.00€
25 microgramos |
Fecha estimada de envío: 11-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
- Theoretical MW (kDa): 42.79
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
Antibody Production, ELISA, Protein Array, Western Blot | |
43.2 | |
In vitro wheat germ expression system | |
Wheat Germ (in vitro) | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Human | |
Solution |