Learn More
Abnova™ ID1 Recombinant Protein
Descripción
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
- Theoretical MW (kDa): 42.79
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
Especificaciones
| Número de acceso | AAH00613.1 |
| Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID de gen (Entrez) | 3397 |
| Peso molecular | 43.2 |
| Nombre | ID1 (Human) Recombinant Protein (P01) |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Método de purificación | Glutathione Sepharose 4 Fast Flow |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Mostrar más |
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.