missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ID1 Recombinant Protein

Código de producto. 16196531
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16196531 10 μg 10 microgramos
16106541 25 μg 25 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16196531 Proveedor Abnova™ N.º de proveedor H00003397P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Human ID1 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.

  • Theoretical MW (kDa): 42.79
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso AAH00613.1
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 3397
Peso molecular 43.2
Nombre ID1 (Human) Recombinant Protein (P01)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Fuente Wheat Germ (in vitro)
Inmunógeno MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen ID/bHLHb24
Nombre común ID1
Símbolo de gen ID1
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.