missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human YTHDC1 (aa 69-160) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96608
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57670 (PA5-57670. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be part of a signal transduction pathway that influences splice site selection. Target protein binds nuclear transcriptosomal complex scaffold attachment factor B (SAF-B) and Sam68; may play a role in splice site selection and alternative splicing.
Especificaciones
| Q96MU7 | |
| Blocking Assay, Control | |
| 91746 | |
| 100 μL | |
| A730098D12Rik; C80342; KIAA1966; mKIAA1966; putative splicing factor YT521; RA301-binding protein; Splicing factor YT521; splicing factor YT521-B; YT521; YT521-B; YTH domain containing 1; YTH domain-containing protein 1; YTHDC1 | |
| YTHDC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human YTHDC1 (aa 69-160) Control Fragment | |
| RUO | |
| YTHDC1 | |
| Unconjugated | |
| Recombinant | |
| LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human YTHDC1 (aa 69-160) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido