Learn More
Abnova™ Human SLC25A16 Partial ORF (NP_689920.1, 59 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008034-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]
Sequence: RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHREspecificaciones
NP_689920.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.99kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR | |
RUO | |
SLC25A16 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
8034 | |
SLC25A16 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
D10S105E/GDA/GDC/HGT.1/MGC39851/ML7/hML7 | |
SLC25A16 | |
Recombinant | |
wheat germ expression system |