missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC25A16 Partial ORF (NP_689920.1, 59 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00008034-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16168165

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]

Sequence: RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
Especificaciones

Especificaciones

NP_689920.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.99kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
RUO
SLC25A16
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
8034
SLC25A16 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
D10S105E/GDA/GDC/HGT.1/MGC39851/ML7/hML7
SLC25A16
Recombinant
wheat germ expression system
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales