missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Separase (aa 961-1110) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109327
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139984 (PA5-139984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Caspase-like protease, which plays a central role in the chromosome segregation by cleaving the SCC1/RAD21 subunit of the cohesin complex at the onset of anaphase. During most of the cell cycle, it is inactivated by different mechanisms.
Especificaciones
| Q14674 | |
| Blocking Assay, Control | |
| 9700 | |
| 100 μL | |
| AL024103; AU045071; Caspase-like protein ESPL1; Cerp; Cut1/ESP1 related protein; ESP1; ESPL1; extra spindle pole bodies 1 (S. cerevisiae); extra spindle pole bodies 1, separase; extra spindle pole bodies homolog 1; extra spindle pole bodies homolog 1 (S. cerevisiae); extra spindle pole bodies like 1, separase; extra spindle poles like 1; extra spindle poles-like 1 protein; FLJ46492; KIAA0165; PRCE; SEPA; separase; Separin; separin, cysteine protease; SSE | |
| ESPL1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Separase (aa 961-1110) Control Fragment | |
| RUO | |
| Separase | |
| Unconjugated | |
| Recombinant | |
| TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human Separase (aa 961-1110) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido