Learn More
Abnova™ Human SCN9A Partial ORF (NP_002968, 269 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
344.00€ - 521.00€
Especificaciones
Número de acceso | NP_002968 |
---|---|
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 6335 |
Peso molecular | 33.55kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16154975
|
Abnova™
H00006335-Q01.10ug |
10 ug |
344.00€
10 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
16164975
|
Abnova™
H00006335-Q01.25ug |
25 ug |
521.00€
25 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq]
Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYEspecificaciones
NP_002968 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.55kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ETHA/NE-NA/NENA/Nav1.7/PN1 | |
SCN9A | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6335 | |
SCN9A (Human) Recombinant Protein (Q01) | |
GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY | |
RUO | |
SCN9A | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.