missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PTPN22 Partial ORF (NP_057051.2, 10 a.a. - 113 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00026191-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]
Sequence: FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFEspecificaciones
| NP_057051.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.18kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDF | |
| RUO | |
| PTPN22 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 26191 | |
| PTPN22 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LYP/Lyp1/Lyp2/PEP/PTPN8 | |
| PTPN22 | |
| Recombinant | |
| wheat germ expression system |
Seguridad y manipulación
Nombre del producto
Palabra de advertencia
Clasificación
Indicaciones de peligro
Consejos de prudencia
Otros peligros
- 25UG PTPN22 (Human) Recombinant Protein (Q01)
Palabra de advertencia
- Atención
Clasificación
- Toxicidad aguda Categoría 4
- Lesión ocular grave/irritación ocular Categoría 2
- Corrosión o irritación cutáneas Categoría 2
Indicaciones de peligro
- H302-Nocivo en caso de ingestión.
- H315-Provoca irritación cutánea.
- H319-Provoca irritación ocular grave.
Consejos de prudencia
- P102-Mantener fuera del alcance de los niños.
- P103-Leer la etiqueta antes del uso.
- P233-Mantener el recipiente herméticamente cerrado.
- P264-Lavarse concienzudamente tras la manipulación.
- P270-No comer, beber ni fumar durante su utilización.
- P280-Llevar guantes/prendas/gafas/máscara de protección.
- P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
- P303+P361+P353-EN CASO DE CONTACTO CON LA PIEL (o el pelo): Quitar inmediatamente todas las prendas contaminadas. Aclararse la piel con agua/ducharse.
- P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
- P404-Almacenar en un recipiente cerrado.
- P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
Otros peligros
- MIXTURE LIST-Contém: Tris-HCl, reduced glutathione