Learn More
Abnova™ Human PPP2R3B Full-length ORF (AAH09032, 1 a.a. - 176 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00028227-P02.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B″/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B″ family. The B″ family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B″. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Sequence: MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESLEspecificaciones
AAH09032 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
45.1kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NY-REN-8/PPP2R3L/PPP2R3LY/PR48 | |
PPP2R3B | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
28227 | |
PPP2R3B (Human) Recombinant Protein (P02) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL | |
RUO | |
PPP2R3B | |
Wheat Germ (in vitro) | |
GST | |
Liquid |