missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PIGY Full-length ORF (NP_001036081.1, 1 a.a. - 71 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00084992-P02.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes two proteins, one of which is part of the GPI-N-acetylglucosaminyltransferase (GIP-GnT) complex which initiates the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is synthesized in the endoplasmic reticulum and serves as an anchor for many surface proteins. Proteins containing GPI anchors can have an important role in cell-cell interactions. Two open reading frames have been found in the single transcript that has been identified for this gene. The downstream open reading frame encodes the GPI-GnT complex protein while the upstream open reading frame encodes a protein with unknown function. [provided by RefSeq]
Sequence: MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHNEspecificaciones
| NP_001036081.1 | |
| Liquid | |
| 84992 | |
| PIGY (Human) Recombinant Protein (P02) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN | |
| RUO | |
| PIGY | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.21kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC14156/PIG-Y | |
| PIGY | |
| Yes | |
| wheat germ expression system |