Learn More
Abnova™ Human NNAT Partial ORF (NP_005377.1, 22 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00004826-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]
Sequence: LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPNEspecificaciones
NP_005377.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.34kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN | |
RUO | |
NNAT | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
4826 | |
NNAT (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC1439/Peg5 | |
NNAT | |
Recombinant | |
wheat germ expression system |