missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NKX2-3 Partial ORF (NP_660328.1, 1 a.a. - 56 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00159296-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]
Sequence: MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSEspecificaciones
| NP_660328.1 | |
| Liquid | |
| 159296 | |
| NKX2-3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CSX3/NK2.3/NKX2.3/NKX2C/NKX4-3 | |
| NKX2-3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.9kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFS | |
| RUO | |
| NKX2-3 | |
| Wheat Germ (in vitro) | |
| GST |