Learn More
Abnova™ Human MT Partial ORF (NP_775738, 291 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00027349-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPREspecificaciones
NP_775738 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR | |
RUO | |
MCAT | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
27349 | |
MT (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FASN2C/MCT/MGC47838/MT/fabD | |
MCAT | |
Recombinant | |
wheat germ expression system |