Learn More
Abnova™ Human GLS Partial ORF (NP_055720, 580 a.a. - 669 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002744-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]
Sequence: EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLLEspecificaciones
NP_055720 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL | |
RUO | |
GLS | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
2744 | |
GLS (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
AAD20/DKFZp686O15119/FLJ10358/GLS1/KIAA0838 | |
GLS | |
Recombinant | |
wheat germ expression system |