missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GFRA1 Partial ORF (NP_005255.1, 267 a.a. - 360 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002674-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]
Sequence: CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPVEspecificaciones
| NP_005255.1 | |
| Liquid | |
| 2674 | |
| GFRA1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GDNFR/GDNFRA/GFR-ALPHA-1/MGC23045/RET1L/RETL1/TRNR1 | |
| GFRA1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.97kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV | |
| RUO | |
| GFRA1 | |
| Wheat Germ (in vitro) | |
| GST |