Learn More
Abnova™ Human GFRA1 Partial ORF (NP_005255.1, 267 a.a. - 360 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
en la oferta
Especificaciones
Número de acceso | NP_005255.1 |
---|---|
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 2674 |
Peso molecular | 35.97kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16158644
|
Abnova™
H00002674-Q01.10UG |
10 ug |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
16168644
|
Abnova™
H00002674-Q01.25UG |
25 ug |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Descripción
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]
Sequence: CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPVEspecificaciones
NP_005255.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.97kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GDNFR/GDNFRA/GFR-ALPHA-1/MGC23045/RET1L/RETL1/TRNR1 | |
GFRA1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2674 | |
GFRA1 (Human) Recombinant Protein (Q01) | |
CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV | |
RUO | |
GFRA1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |