missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXG1 Partial ORF (CAA52241.1, 164 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002290-Q03.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. [provided by RefSeq]
Sequence: SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEEspecificaciones
| CAA52241.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.45kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE | |
| RUO | |
| FOXG1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2290 | |
| FOXG1 (Human) Recombinant Protein (Q03) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BF1/BF2/FHKL3/FKH2/FKHL1/FKHL2/FKHL3/FKHL4/FOXG1A/FOXG1B/FOXG1C/HBF-1/HBF-2/HBF-3/HBF-G2/HBF2/HFK1/HFK2/HFK3/KHL2/QIN | |
| FOXG1 | |
| Recombinant | |
| wheat germ expression system |