missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human F2R Partial ORF (NP_001983.1, 42 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002149-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. [provided by RefSeq]
Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTEspecificaciones
| NP_001983.1 | |
| Liquid | |
| 2149 | |
| F2R (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CF2R/HTR/PAR1/TR | |
| F2R | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.45kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT | |
| RUO | |
| F2R | |
| Wheat Germ (in vitro) | |
| GST |