missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DOK5 Partial ORF (NP_808874, 130 a.a. - 198 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00055816-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The protein encoded by this gene is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. The encoded protein interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP. [provided by RefSeq]
Sequence: LQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEHEspecificaciones
| NP_808874 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.33kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH | |
| RUO | |
| DOK5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 55816 | |
| DOK5 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C20orf180/MGC16926 | |
| DOK5 | |
| Recombinant | |
| wheat germ expression system |