missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COX6B2 Full-length ORF (NP_653214.2, 1 a.a. - 88 a.a.) Recombinant Protein with GST-tag at N-terminal

Liquid

341.70€ - 518.16€

Especificaciones

Nombre COX6B2 (Human) Recombinant Protein (P02)
Recombinante Yes
Método de purificación Glutathione Sepharose 4 Fast Flow
Para utilizar con (aplicación) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Peso molecular 35.42kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16117693
Ver documentos Detalles de la promoción
Abnova™
H00125965-P02.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 24-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16107693
Ver documentos Detalles de la promoción
Abnova™
H00125965-P02.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 24-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Especificaciones

Especificaciones

COX6B2 (Human) Recombinant Protein (P02)
Glutathione Sepharose 4 Fast Flow
35.42kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications