missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C1QBP Full-length ORF (NP_001203.1, 1 a.a. - 282 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000708-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq]
Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQEspecificaciones
| NP_001203.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 57.8kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GC1QBP/HABP1/SF2p32/gC1Q-R/gC1qR/p32 | |
| C1QBP | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 708 | |
| C1QBP (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ | |
| RUO | |
| C1QBP | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
Seguridad y manipulación
Nombre del producto
Palabra de advertencia
Clasificación
Indicaciones de peligro
Consejos de prudencia
Otros peligros
- C1QBP (Human) Recombinant Protein (P01)
Palabra de advertencia
- Atención
Clasificación
- Toxicidad aguda Categoría 4
- Lesión ocular grave/irritación ocular Categoría 2
- Corrosión o irritación cutáneas Categoría 2
Indicaciones de peligro
- H302-Nocivo en caso de ingestión.
- H315-Provoca irritación cutánea.
- H319-Provoca irritación ocular grave.
Consejos de prudencia
- P102-Mantener fuera del alcance de los niños.
- P103-Leer la etiqueta antes del uso.
- P233-Mantener el recipiente herméticamente cerrado.
- P264-Lavarse concienzudamente tras la manipulación.
- P270-No comer, beber ni fumar durante su utilización.
- P280-Llevar guantes/prendas/gafas/máscara de protección.
- P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
- P303+P361+P353-EN CASO DE CONTACTO CON LA PIEL (o el pelo): Quitar inmediatamente todas las prendas contaminadas. Aclararse la piel con agua/ducharse.
- P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
- P404-Almacenar en un recipiente cerrado.
- P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
Otros peligros
- MIXTURE LIST-Contém: sodium phosphate dibasic, potassium phosphate monobasic