missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BTAF1 Partial ORF (NP_003963, 1750 a.a. - 1849 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00009044-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Initiation of transcription by RNA polymerase II requires the assistance of TATA box-binding protein (TBP; MIM 600075) and TBP-associated factors, or TAFs (e.g., TAF2B; MIM 604912), in 2 distinct complexes, TFIID and B-TFIID. The TFIID complex is composed of TBP and more than 8 TAFs. However, the majority of TBP is present in the B-TFIID complex, which is composed of TBP and TAFII170, also called TAF172, and has DNA-dependent ATPase activity.[supplied by OMIM]
Sequence: NVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLKEspecificaciones
| NP_003963 | |
| Liquid | |
| 9044 | |
| BTAF1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KIAA0940/MGC138406/MOT1/TAF(II)170/TAF172/TAFII170 | |
| BTAF1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK | |
| RUO | |
| BTAF1 | |
| Wheat Germ (in vitro) | |
| GST |