Learn More
Invitrogen™ Human ARHGAP11A (aa 922-1021) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109105
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARHGAP11A is a protein coding gene. Gene Ontology (GO) annotations related to this gene include signal transduction.
Especificaciones
Q6P4F7 | |
Blocking Assay, Control | |
9824 | |
100 μL | |
6530401L14Rik; Arhgap11a; GAP (1-12); Kiaa0013; mKIAA0013; RGD1309107; Rho GTPase activating protein 11 A; rho GTPase-activating protein 11 A; Rho-type GTPase-activating protein 11 A | |
ARHGAP11A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ARHGAP11A (aa 922-1021) Control Fragment | |
RUO | |
ARHGAP11A | |
Unconjugated | |
Recombinant | |
ELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.