missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GNRHR2 (Human) Recombinant Protein
Human GNRHR2 partial ORF ( NP_001457, 237 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00114814-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Especificaciones
| NP_001457 | |
| gonadotropin-releasing hormone (type 2) receptor 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GNRHR2 | |
| GST |
| 114814 | |
| Wheat germ expression system | |
| 10 μg | |
| GnRH-II-R | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |