missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Desmin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-85549-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Desmin Polyclonal antibody specifically detects Desmin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| Desmin | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CMD1IFLJ41013, CSM1, CSM2, desmin, FLJ12025, FLJ39719, FLJ41793, intermediate filament protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL | |
| 25 μL | |
| Cell Biology, Cellular Markers | |
| 1674 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Desmin Antibody, Novus Biologicals™ > 25 μL; Unconjugated
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido