missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Desmin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-85549-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Desmin Polyclonal antibody specifically detects Desmin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
Desmin | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
CMD1IFLJ41013, CSM1, CSM2, desmin, FLJ12025, FLJ39719, FLJ41793, intermediate filament protein | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL | |
25 μL | |
Cell Biology, Cellular Markers | |
1674 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Desmin Antibody, Novus Biologicals™ > 25 μL; Unconjugated
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu