missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSDE1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Marca: Novus Biologicals NBP3-33278-20ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CSDE1 Monoclonal antibody specifically detects CSDE1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Especificaciones
| CSDE1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| cold shock domain containing E1, RNA-binding, cold shock domain-containing protein E1, D1S155EUNRRP5-1000E10.3, DKFZp779B0247, DKFZp779J1455, FLJ26882, KIAA0885, N-ras upstream gene protein, NRAS-related, NRU, Protein UNR, upstream of NRAS | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4).,, Sequence:, MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM | |
| 20 μL | |
| Primary | |
| Human, Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7812 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
CSDE1 Antibody, Novus Biologicals™ > 20 μL; Unconjugated
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido