missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CA2 (Human) Recombinant Protein

Human CA2 partial ORF (NP_000058.1, 191 a.a. - 260 a.a.) recombinant protein with GST tag at N-terminal.

Marca:  Abnova™ H00000760-Q01.10ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16033705

  • 359.00€ / 10 microgramos
Fecha estimada de envío: 01-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Especificaciones

Especificaciones

NP_000058.1
carbonic anhydrase II
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CA2
GST
760
Wheat germ expression system
10 μg
CA-II, CAII, Car2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales