missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CA2 (Human) Recombinant Protein

Human CA2 partial ORF (NP_000058.1, 191 a.a. - 260 a.a.) recombinant protein with GST tag at N-terminal.

359.00€ - 545.00€

Especificaciones

Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ID de gen (Entrez) 760
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16033705
Ver documentos Detalles de la promoción
Abnova™
H00000760-Q01.10UG
10 μg
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16043705
Ver documentos Detalles de la promoción
Abnova™
H00000760-Q01.25UG
25 μg
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Sequence: WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Especificaciones

Especificaciones

Store at -80°C. Aliquot to avoid repeated freezing and thawing.
760
SDS
Product Certifications