Sequence: VWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELG
beta-D-xylosyltransferase 1; Peptide O-xylosyltransferase 1; XT-I; XT-I/XT1; Xylosyltransferase 1; Xylosyltransferase I; xylosyltransferase iota
Cat # 16103470
100 uL
Cat # 15750391
100 µL
Cat # 15866043
100 µL
Cat # 15760441
100 µL
Cat # 16183480
100 uL
Cat # 15662745
400 µL
Cat # 16846505
150 µL
Cat # 16856505
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.